General Information

  • ID:  hor005515
  • Uniprot ID:  P55246
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  VQVVVLALVAQVTLSQHWSYGWLPGGKRSVGELEATIKMMDTGGVVVLPEETSAHVSERLRPYDVILKKWMPHK
  • Length:  74(1-74)
  • Propeptide:  VQVVVLALVAQVTLSQHWSYGWLPGGKRSVGELEATIKMMDTGGVVVLPEETSAHVSERLRPYDVILKKWMPHK
  • Signal peptide:  VQVVVLALVAQVTLS
  • Modification:  T16 Pyrrolidone carboxylic acid;T25 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P55246-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P55246-F1.pdbhor005515_AF2.pdbhor005515_ESM.pdb

Physical Information

Mass: 955596 Formula: C375H600N100O103S3
Absent amino acids: CFN Common amino acids: V
pI: 9.07 Basic residues: 11
Polar residues: 17 Hydrophobic residues: 29
Hydrophobicity: 5.68 Boman Index: -5756
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 105.14
Instability Index: 5675 Extinction Coefficient cystines: 19480
Absorbance 280nm: 266.85

Literature

  • PubMed ID:  NA
  • Title:  The salmon gonadotrophin-releasing hormone encoding gene in salmonids.